Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet
published on Tuesday, Apr 21, 2026 by ciscodevnet
Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet
published on Tuesday, Apr 21, 2026 by ciscodevnet
Service item health check definition metadata.
Using getWorkflowServiceItemHealthCheckDefinition
Two invocation forms are available. The direct form accepts plain arguments and either blocks until the result value is available, or returns a Promise-wrapped result. The output form accepts Input-wrapped arguments and returns an Output-wrapped result.
function getWorkflowServiceItemHealthCheckDefinition(args: GetWorkflowServiceItemHealthCheckDefinitionArgs, opts?: InvokeOptions): Promise<GetWorkflowServiceItemHealthCheckDefinitionResult>
function getWorkflowServiceItemHealthCheckDefinitionOutput(args: GetWorkflowServiceItemHealthCheckDefinitionOutputArgs, opts?: InvokeOptions): Output<GetWorkflowServiceItemHealthCheckDefinitionResult>def get_workflow_service_item_health_check_definition(account_moid: Optional[str] = None,
additional_properties: Optional[str] = None,
ancestors: Optional[Sequence[GetWorkflowServiceItemHealthCheckDefinitionAncestor]] = None,
category: Optional[str] = None,
class_id: Optional[str] = None,
common_cause_and_resolution: Optional[str] = None,
create_time: Optional[str] = None,
description: Optional[str] = None,
domain_group_moid: Optional[str] = None,
execution_mode: Optional[str] = None,
health_check_workflow: Optional[GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow] = None,
id: Optional[str] = None,
label: Optional[str] = None,
mod_time: Optional[str] = None,
moid: Optional[str] = None,
name: Optional[str] = None,
object_type: Optional[str] = None,
owners: Optional[Sequence[str]] = None,
parent: Optional[GetWorkflowServiceItemHealthCheckDefinitionParent] = None,
permission_resources: Optional[Sequence[GetWorkflowServiceItemHealthCheckDefinitionPermissionResource]] = None,
service_item_definition: Optional[GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition] = None,
shared_scope: Optional[str] = None,
tags: Optional[Sequence[GetWorkflowServiceItemHealthCheckDefinitionTag]] = None,
version_context: Optional[GetWorkflowServiceItemHealthCheckDefinitionVersionContext] = None,
opts: Optional[InvokeOptions] = None) -> GetWorkflowServiceItemHealthCheckDefinitionResult
def get_workflow_service_item_health_check_definition_output(account_moid: pulumi.Input[Optional[str]] = None,
additional_properties: pulumi.Input[Optional[str]] = None,
ancestors: pulumi.Input[Optional[Sequence[pulumi.Input[GetWorkflowServiceItemHealthCheckDefinitionAncestorArgs]]]] = None,
category: pulumi.Input[Optional[str]] = None,
class_id: pulumi.Input[Optional[str]] = None,
common_cause_and_resolution: pulumi.Input[Optional[str]] = None,
create_time: pulumi.Input[Optional[str]] = None,
description: pulumi.Input[Optional[str]] = None,
domain_group_moid: pulumi.Input[Optional[str]] = None,
execution_mode: pulumi.Input[Optional[str]] = None,
health_check_workflow: pulumi.Input[Optional[GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowArgs]] = None,
id: pulumi.Input[Optional[str]] = None,
label: pulumi.Input[Optional[str]] = None,
mod_time: pulumi.Input[Optional[str]] = None,
moid: pulumi.Input[Optional[str]] = None,
name: pulumi.Input[Optional[str]] = None,
object_type: pulumi.Input[Optional[str]] = None,
owners: pulumi.Input[Optional[Sequence[pulumi.Input[str]]]] = None,
parent: pulumi.Input[Optional[GetWorkflowServiceItemHealthCheckDefinitionParentArgs]] = None,
permission_resources: pulumi.Input[Optional[Sequence[pulumi.Input[GetWorkflowServiceItemHealthCheckDefinitionPermissionResourceArgs]]]] = None,
service_item_definition: pulumi.Input[Optional[GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinitionArgs]] = None,
shared_scope: pulumi.Input[Optional[str]] = None,
tags: pulumi.Input[Optional[Sequence[pulumi.Input[GetWorkflowServiceItemHealthCheckDefinitionTagArgs]]]] = None,
version_context: pulumi.Input[Optional[GetWorkflowServiceItemHealthCheckDefinitionVersionContextArgs]] = None,
opts: Optional[InvokeOptions] = None) -> Output[GetWorkflowServiceItemHealthCheckDefinitionResult]func LookupWorkflowServiceItemHealthCheckDefinition(ctx *Context, args *LookupWorkflowServiceItemHealthCheckDefinitionArgs, opts ...InvokeOption) (*LookupWorkflowServiceItemHealthCheckDefinitionResult, error)
func LookupWorkflowServiceItemHealthCheckDefinitionOutput(ctx *Context, args *LookupWorkflowServiceItemHealthCheckDefinitionOutputArgs, opts ...InvokeOption) LookupWorkflowServiceItemHealthCheckDefinitionResultOutput> Note: This function is named LookupWorkflowServiceItemHealthCheckDefinition in the Go SDK.
public static class GetWorkflowServiceItemHealthCheckDefinition
{
public static Task<GetWorkflowServiceItemHealthCheckDefinitionResult> InvokeAsync(GetWorkflowServiceItemHealthCheckDefinitionArgs args, InvokeOptions? opts = null)
public static Output<GetWorkflowServiceItemHealthCheckDefinitionResult> Invoke(GetWorkflowServiceItemHealthCheckDefinitionInvokeArgs args, InvokeOptions? opts = null)
}public static CompletableFuture<GetWorkflowServiceItemHealthCheckDefinitionResult> getWorkflowServiceItemHealthCheckDefinition(GetWorkflowServiceItemHealthCheckDefinitionArgs args, InvokeOptions options)
public static Output<GetWorkflowServiceItemHealthCheckDefinitionResult> getWorkflowServiceItemHealthCheckDefinition(GetWorkflowServiceItemHealthCheckDefinitionArgs args, InvokeOptions options)
fn::invoke:
function: intersight:index/getWorkflowServiceItemHealthCheckDefinition:getWorkflowServiceItemHealthCheckDefinition
arguments:
# arguments dictionarydata "intersight_getworkflowserviceitemhealthcheckdefinition" "name" {
# arguments
}The following arguments are supported:
- Account
Moid string - The Account ID for this managed object.
- Additional
Properties string - Ancestors
List<Get
Workflow Service Item Health Check Definition Ancestor> - Category string
- Category that the health check belongs to.
- Class
Id string - Common
Cause stringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- Create
Time string - The time when this managed object was created.
- Description string
- Description of the health check definition.
- Domain
Group stringMoid - The DomainGroup ID for this managed object.
- Execution
Mode string - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - Health
Check GetWorkflow Workflow Service Item Health Check Definition Health Check Workflow - Id string
- Label string
- Label for the health check definition that is displayed on UI.
- Mod
Time string - The time when this managed object was last modified.
- Moid string
- The unique identifier of this Managed Object instance.
- Name string
- Name of the health check definition.
- Object
Type string - Owners List<string>
- Parent
Get
Workflow Service Item Health Check Definition Parent - Permission
Resources List<GetWorkflow Service Item Health Check Definition Permission Resource> - Service
Item GetDefinition Workflow Service Item Health Check Definition Service Item Definition - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
List<Get
Workflow Service Item Health Check Definition Tag> - Version
Context GetWorkflow Service Item Health Check Definition Version Context
- Account
Moid string - The Account ID for this managed object.
- Additional
Properties string - Ancestors
[]Get
Workflow Service Item Health Check Definition Ancestor - Category string
- Category that the health check belongs to.
- Class
Id string - Common
Cause stringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- Create
Time string - The time when this managed object was created.
- Description string
- Description of the health check definition.
- Domain
Group stringMoid - The DomainGroup ID for this managed object.
- Execution
Mode string - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - Health
Check GetWorkflow Workflow Service Item Health Check Definition Health Check Workflow - Id string
- Label string
- Label for the health check definition that is displayed on UI.
- Mod
Time string - The time when this managed object was last modified.
- Moid string
- The unique identifier of this Managed Object instance.
- Name string
- Name of the health check definition.
- Object
Type string - Owners []string
- Parent
Get
Workflow Service Item Health Check Definition Parent - Permission
Resources []GetWorkflow Service Item Health Check Definition Permission Resource - Service
Item GetDefinition Workflow Service Item Health Check Definition Service Item Definition - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
[]Get
Workflow Service Item Health Check Definition Tag - Version
Context GetWorkflow Service Item Health Check Definition Version Context
- account_
moid string - The Account ID for this managed object.
- additional_
properties string - ancestors list(object)
- category string
- Category that the health check belongs to.
- class_
id string - common_
cause_ stringand_ resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create_
time string - The time when this managed object was created.
- description string
- Description of the health check definition.
- domain_
group_ stringmoid - The DomainGroup ID for this managed object.
- execution_
mode string - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health_
check_ objectworkflow - id string
- label string
- Label for the health check definition that is displayed on UI.
- mod_
time string - The time when this managed object was last modified.
- moid string
- The unique identifier of this Managed Object instance.
- name string
- Name of the health check definition.
- object_
type string - owners list(string)
- parent object
- permission_
resources list(object) - service_
item_ objectdefinition - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- list(object)
- version_
context object
- account
Moid String - The Account ID for this managed object.
- additional
Properties String - ancestors
List<Get
Workflow Service Item Health Check Definition Ancestor> - category String
- Category that the health check belongs to.
- class
Id String - common
Cause StringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create
Time String - The time when this managed object was created.
- description String
- Description of the health check definition.
- domain
Group StringMoid - The DomainGroup ID for this managed object.
- execution
Mode String - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health
Check GetWorkflow Workflow Service Item Health Check Definition Health Check Workflow - id String
- label String
- Label for the health check definition that is displayed on UI.
- mod
Time String - The time when this managed object was last modified.
- moid String
- The unique identifier of this Managed Object instance.
- name String
- Name of the health check definition.
- object
Type String - owners List<String>
- parent
Get
Workflow Service Item Health Check Definition Parent - permission
Resources List<GetWorkflow Service Item Health Check Definition Permission Resource> - service
Item GetDefinition Workflow Service Item Health Check Definition Service Item Definition - String
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
List<Get
Workflow Service Item Health Check Definition Tag> - version
Context GetWorkflow Service Item Health Check Definition Version Context
- account
Moid string - The Account ID for this managed object.
- additional
Properties string - ancestors
Get
Workflow Service Item Health Check Definition Ancestor[] - category string
- Category that the health check belongs to.
- class
Id string - common
Cause stringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create
Time string - The time when this managed object was created.
- description string
- Description of the health check definition.
- domain
Group stringMoid - The DomainGroup ID for this managed object.
- execution
Mode string - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health
Check GetWorkflow Workflow Service Item Health Check Definition Health Check Workflow - id string
- label string
- Label for the health check definition that is displayed on UI.
- mod
Time string - The time when this managed object was last modified.
- moid string
- The unique identifier of this Managed Object instance.
- name string
- Name of the health check definition.
- object
Type string - owners string[]
- parent
Get
Workflow Service Item Health Check Definition Parent - permission
Resources GetWorkflow Service Item Health Check Definition Permission Resource[] - service
Item GetDefinition Workflow Service Item Health Check Definition Service Item Definition - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
Get
Workflow Service Item Health Check Definition Tag[] - version
Context GetWorkflow Service Item Health Check Definition Version Context
- account_
moid str - The Account ID for this managed object.
- additional_
properties str - ancestors
Sequence[Get
Workflow Service Item Health Check Definition Ancestor] - category str
- Category that the health check belongs to.
- class_
id str - common_
cause_ strand_ resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create_
time str - The time when this managed object was created.
- description str
- Description of the health check definition.
- domain_
group_ strmoid - The DomainGroup ID for this managed object.
- execution_
mode str - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health_
check_ Getworkflow Workflow Service Item Health Check Definition Health Check Workflow - id str
- label str
- Label for the health check definition that is displayed on UI.
- mod_
time str - The time when this managed object was last modified.
- moid str
- The unique identifier of this Managed Object instance.
- name str
- Name of the health check definition.
- object_
type str - owners Sequence[str]
- parent
Get
Workflow Service Item Health Check Definition Parent - permission_
resources Sequence[GetWorkflow Service Item Health Check Definition Permission Resource] - service_
item_ Getdefinition Workflow Service Item Health Check Definition Service Item Definition - str
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
Sequence[Get
Workflow Service Item Health Check Definition Tag] - version_
context GetWorkflow Service Item Health Check Definition Version Context
- account
Moid String - The Account ID for this managed object.
- additional
Properties String - ancestors List<Property Map>
- category String
- Category that the health check belongs to.
- class
Id String - common
Cause StringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create
Time String - The time when this managed object was created.
- description String
- Description of the health check definition.
- domain
Group StringMoid - The DomainGroup ID for this managed object.
- execution
Mode String - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health
Check Property MapWorkflow - id String
- label String
- Label for the health check definition that is displayed on UI.
- mod
Time String - The time when this managed object was last modified.
- moid String
- The unique identifier of this Managed Object instance.
- name String
- Name of the health check definition.
- object
Type String - owners List<String>
- parent Property Map
- permission
Resources List<Property Map> - service
Item Property MapDefinition - String
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- List<Property Map>
- version
Context Property Map
getWorkflowServiceItemHealthCheckDefinition Result
The following output properties are available:
- Id string
- Results
List<Get
Workflow Service Item Health Check Definition Result> - Account
Moid string - Additional
Properties string - Ancestors
List<Get
Workflow Service Item Health Check Definition Ancestor> - Category string
- Class
Id string - Common
Cause stringAnd Resolution - Create
Time string - Description string
- Domain
Group stringMoid - Execution
Mode string - Health
Check GetWorkflow Workflow Service Item Health Check Definition Health Check Workflow - Label string
- Mod
Time string - Moid string
- Name string
- Object
Type string - Owners List<string>
- Parent
Get
Workflow Service Item Health Check Definition Parent - Permission
Resources List<GetWorkflow Service Item Health Check Definition Permission Resource> - Service
Item GetDefinition Workflow Service Item Health Check Definition Service Item Definition - string
-
List<Get
Workflow Service Item Health Check Definition Tag> - Version
Context GetWorkflow Service Item Health Check Definition Version Context
- Id string
- Results
[]Get
Workflow Service Item Health Check Definition Result - Account
Moid string - Additional
Properties string - Ancestors
[]Get
Workflow Service Item Health Check Definition Ancestor - Category string
- Class
Id string - Common
Cause stringAnd Resolution - Create
Time string - Description string
- Domain
Group stringMoid - Execution
Mode string - Health
Check GetWorkflow Workflow Service Item Health Check Definition Health Check Workflow - Label string
- Mod
Time string - Moid string
- Name string
- Object
Type string - Owners []string
- Parent
Get
Workflow Service Item Health Check Definition Parent - Permission
Resources []GetWorkflow Service Item Health Check Definition Permission Resource - Service
Item GetDefinition Workflow Service Item Health Check Definition Service Item Definition - string
-
[]Get
Workflow Service Item Health Check Definition Tag - Version
Context GetWorkflow Service Item Health Check Definition Version Context
- id string
- results list(object)
- account_
moid string - additional_
properties string - ancestors list(object)
- category string
- class_
id string - common_
cause_ stringand_ resolution - create_
time string - description string
- domain_
group_ stringmoid - execution_
mode string - health_
check_ objectworkflow - label string
- mod_
time string - moid string
- name string
- object_
type string - owners list(string)
- parent object
- permission_
resources list(object) - service_
item_ objectdefinition - string
- list(object)
- version_
context object
- id String
- results
List<Get
Workflow Service Item Health Check Definition Result> - account
Moid String - additional
Properties String - ancestors
List<Get
Workflow Service Item Health Check Definition Ancestor> - category String
- class
Id String - common
Cause StringAnd Resolution - create
Time String - description String
- domain
Group StringMoid - execution
Mode String - health
Check GetWorkflow Workflow Service Item Health Check Definition Health Check Workflow - label String
- mod
Time String - moid String
- name String
- object
Type String - owners List<String>
- parent
Get
Workflow Service Item Health Check Definition Parent - permission
Resources List<GetWorkflow Service Item Health Check Definition Permission Resource> - service
Item GetDefinition Workflow Service Item Health Check Definition Service Item Definition - String
-
List<Get
Workflow Service Item Health Check Definition Tag> - version
Context GetWorkflow Service Item Health Check Definition Version Context
- id string
- results
Get
Workflow Service Item Health Check Definition Result[] - account
Moid string - additional
Properties string - ancestors
Get
Workflow Service Item Health Check Definition Ancestor[] - category string
- class
Id string - common
Cause stringAnd Resolution - create
Time string - description string
- domain
Group stringMoid - execution
Mode string - health
Check GetWorkflow Workflow Service Item Health Check Definition Health Check Workflow - label string
- mod
Time string - moid string
- name string
- object
Type string - owners string[]
- parent
Get
Workflow Service Item Health Check Definition Parent - permission
Resources GetWorkflow Service Item Health Check Definition Permission Resource[] - service
Item GetDefinition Workflow Service Item Health Check Definition Service Item Definition - string
-
Get
Workflow Service Item Health Check Definition Tag[] - version
Context GetWorkflow Service Item Health Check Definition Version Context
- id str
- results
Sequence[Get
Workflow Service Item Health Check Definition Result] - account_
moid str - additional_
properties str - ancestors
Sequence[Get
Workflow Service Item Health Check Definition Ancestor] - category str
- class_
id str - common_
cause_ strand_ resolution - create_
time str - description str
- domain_
group_ strmoid - execution_
mode str - health_
check_ Getworkflow Workflow Service Item Health Check Definition Health Check Workflow - label str
- mod_
time str - moid str
- name str
- object_
type str - owners Sequence[str]
- parent
Get
Workflow Service Item Health Check Definition Parent - permission_
resources Sequence[GetWorkflow Service Item Health Check Definition Permission Resource] - service_
item_ Getdefinition Workflow Service Item Health Check Definition Service Item Definition - str
-
Sequence[Get
Workflow Service Item Health Check Definition Tag] - version_
context GetWorkflow Service Item Health Check Definition Version Context
- id String
- results List<Property Map>
- account
Moid String - additional
Properties String - ancestors List<Property Map>
- category String
- class
Id String - common
Cause StringAnd Resolution - create
Time String - description String
- domain
Group StringMoid - execution
Mode String - health
Check Property MapWorkflow - label String
- mod
Time String - moid String
- name String
- object
Type String - owners List<String>
- parent Property Map
- permission
Resources List<Property Map> - service
Item Property MapDefinition - String
- List<Property Map>
- version
Context Property Map
Supporting Types
GetWorkflowServiceItemHealthCheckDefinitionAncestor
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflow
- Additional
Properties string - Catalog
Moid string - Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
- Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Description string
- Description of the health check definition.
- Input
Parameters string - Capture the mapping of ActionDefinition inputDefinition to workflow definition.
- Label string
- Label for the health check definition that is displayed on UI.
- Name string
- Name of the health check definition.
- Nr
Version double - The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
- Object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- Workflow
Definition GetWorkflow Service Item Health Check Definition Health Check Workflow Workflow Definition - The moid of the workflow definition.
- Workflow
Definition stringName - The qualified name of workflow that should be executed.
- Additional
Properties string - Catalog
Moid string - Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
- Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Description string
- Description of the health check definition.
- Input
Parameters string - Capture the mapping of ActionDefinition inputDefinition to workflow definition.
- Label string
- Label for the health check definition that is displayed on UI.
- Name string
- Name of the health check definition.
- Nr
Version float64 - The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
- Object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- Workflow
Definition GetWorkflow Service Item Health Check Definition Health Check Workflow Workflow Definition - The moid of the workflow definition.
- Workflow
Definition stringName - The qualified name of workflow that should be executed.
- additional_
properties string - catalog_
moid string - Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
- class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- description string
- Description of the health check definition.
- input_
parameters string - Capture the mapping of ActionDefinition inputDefinition to workflow definition.
- label string
- Label for the health check definition that is displayed on UI.
- name string
- Name of the health check definition.
- nr_
version number - The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
- object_
type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- workflow_
definition object - The moid of the workflow definition.
- workflow_
definition_ stringname - The qualified name of workflow that should be executed.
- additional
Properties String - catalog
Moid String - Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
- class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- description String
- Description of the health check definition.
- input
Parameters String - Capture the mapping of ActionDefinition inputDefinition to workflow definition.
- label String
- Label for the health check definition that is displayed on UI.
- name String
- Name of the health check definition.
- nr
Version Double - The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
- object
Type String - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- workflow
Definition GetWorkflow Service Item Health Check Definition Health Check Workflow Workflow Definition - The moid of the workflow definition.
- workflow
Definition StringName - The qualified name of workflow that should be executed.
- additional
Properties string - catalog
Moid string - Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
- class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- description string
- Description of the health check definition.
- input
Parameters string - Capture the mapping of ActionDefinition inputDefinition to workflow definition.
- label string
- Label for the health check definition that is displayed on UI.
- name string
- Name of the health check definition.
- nr
Version number - The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
- object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- workflow
Definition GetWorkflow Service Item Health Check Definition Health Check Workflow Workflow Definition - The moid of the workflow definition.
- workflow
Definition stringName - The qualified name of workflow that should be executed.
- additional_
properties str - catalog_
moid str - Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
- class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- description str
- Description of the health check definition.
- input_
parameters str - Capture the mapping of ActionDefinition inputDefinition to workflow definition.
- label str
- Label for the health check definition that is displayed on UI.
- name str
- Name of the health check definition.
- nr_
version float - The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
- object_
type str - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- workflow_
definition GetWorkflow Service Item Health Check Definition Health Check Workflow Workflow Definition - The moid of the workflow definition.
- workflow_
definition_ strname - The qualified name of workflow that should be executed.
- additional
Properties String - catalog
Moid String - Specify the catalog moid that this workflow belongs. When catalog moid is not specified then the catalog of the service item is used first and if no workflow can be found in that catalog, then the shared catalog from Intersight is used.
- class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- description String
- Description of the health check definition.
- input
Parameters String - Capture the mapping of ActionDefinition inputDefinition to workflow definition.
- label String
- Label for the health check definition that is displayed on UI.
- name String
- Name of the health check definition.
- nr
Version Number - The workflow definition version to use as subworkflow. When no version is specified then the default version of the workflow at the time of creating or updating this workflow is used.
- object
Type String - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- workflow
Definition Property Map - The moid of the workflow definition.
- workflow
Definition StringName - The qualified name of workflow that should be executed.
GetWorkflowServiceItemHealthCheckDefinitionHealthCheckWorkflowWorkflowDefinition
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetWorkflowServiceItemHealthCheckDefinitionParent
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetWorkflowServiceItemHealthCheckDefinitionPermissionResource
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetWorkflowServiceItemHealthCheckDefinitionResult
- Account
Moid string - The Account ID for this managed object.
- Additional
Properties string - Ancestors
List<Get
Workflow Service Item Health Check Definition Result Ancestor> - Category string
- Category that the health check belongs to.
- Class
Id string - Common
Cause stringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- Create
Time string - The time when this managed object was created.
- Description string
- Description of the health check definition.
- Domain
Group stringMoid - The DomainGroup ID for this managed object.
- Execution
Mode string - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - Health
Check List<GetWorkflows Workflow Service Item Health Check Definition Result Health Check Workflow> - Label string
- Label for the health check definition that is displayed on UI.
- Mod
Time string - The time when this managed object was last modified.
- Moid string
- The unique identifier of this Managed Object instance.
- Name string
- Name of the health check definition.
- Object
Type string - Owners List<string>
- Parents
List<Get
Workflow Service Item Health Check Definition Result Parent> - Permission
Resources List<GetWorkflow Service Item Health Check Definition Result Permission Resource> - Service
Item List<GetDefinitions Workflow Service Item Health Check Definition Result Service Item Definition> - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
List<Get
Workflow Service Item Health Check Definition Result Tag> - Version
Contexts List<GetWorkflow Service Item Health Check Definition Result Version Context>
- Account
Moid string - The Account ID for this managed object.
- Additional
Properties string - Ancestors
[]Get
Workflow Service Item Health Check Definition Result Ancestor - Category string
- Category that the health check belongs to.
- Class
Id string - Common
Cause stringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- Create
Time string - The time when this managed object was created.
- Description string
- Description of the health check definition.
- Domain
Group stringMoid - The DomainGroup ID for this managed object.
- Execution
Mode string - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - Health
Check []GetWorkflows Workflow Service Item Health Check Definition Result Health Check Workflow - Label string
- Label for the health check definition that is displayed on UI.
- Mod
Time string - The time when this managed object was last modified.
- Moid string
- The unique identifier of this Managed Object instance.
- Name string
- Name of the health check definition.
- Object
Type string - Owners []string
- Parents
[]Get
Workflow Service Item Health Check Definition Result Parent - Permission
Resources []GetWorkflow Service Item Health Check Definition Result Permission Resource - Service
Item []GetDefinitions Workflow Service Item Health Check Definition Result Service Item Definition - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
[]Get
Workflow Service Item Health Check Definition Result Tag - Version
Contexts []GetWorkflow Service Item Health Check Definition Result Version Context
- account_
moid string - The Account ID for this managed object.
- additional_
properties string - ancestors list(object)
- category string
- Category that the health check belongs to.
- class_
id string - common_
cause_ stringand_ resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create_
time string - The time when this managed object was created.
- description string
- Description of the health check definition.
- domain_
group_ stringmoid - The DomainGroup ID for this managed object.
- execution_
mode string - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health_
check_ list(object)workflows - label string
- Label for the health check definition that is displayed on UI.
- mod_
time string - The time when this managed object was last modified.
- moid string
- The unique identifier of this Managed Object instance.
- name string
- Name of the health check definition.
- object_
type string - owners list(string)
- parents list(object)
- permission_
resources list(object) - service_
item_ list(object)definitions - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- list(object)
- version_
contexts list(object)
- account
Moid String - The Account ID for this managed object.
- additional
Properties String - ancestors
List<Get
Workflow Service Item Health Check Definition Result Ancestor> - category String
- Category that the health check belongs to.
- class
Id String - common
Cause StringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create
Time String - The time when this managed object was created.
- description String
- Description of the health check definition.
- domain
Group StringMoid - The DomainGroup ID for this managed object.
- execution
Mode String - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health
Check List<GetWorkflows Workflow Service Item Health Check Definition Result Health Check Workflow> - label String
- Label for the health check definition that is displayed on UI.
- mod
Time String - The time when this managed object was last modified.
- moid String
- The unique identifier of this Managed Object instance.
- name String
- Name of the health check definition.
- object
Type String - owners List<String>
- parents
List<Get
Workflow Service Item Health Check Definition Result Parent> - permission
Resources List<GetWorkflow Service Item Health Check Definition Result Permission Resource> - service
Item List<GetDefinitions Workflow Service Item Health Check Definition Result Service Item Definition> - String
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
List<Get
Workflow Service Item Health Check Definition Result Tag> - version
Contexts List<GetWorkflow Service Item Health Check Definition Result Version Context>
- account
Moid string - The Account ID for this managed object.
- additional
Properties string - ancestors
Get
Workflow Service Item Health Check Definition Result Ancestor[] - category string
- Category that the health check belongs to.
- class
Id string - common
Cause stringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create
Time string - The time when this managed object was created.
- description string
- Description of the health check definition.
- domain
Group stringMoid - The DomainGroup ID for this managed object.
- execution
Mode string - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health
Check GetWorkflows Workflow Service Item Health Check Definition Result Health Check Workflow[] - label string
- Label for the health check definition that is displayed on UI.
- mod
Time string - The time when this managed object was last modified.
- moid string
- The unique identifier of this Managed Object instance.
- name string
- Name of the health check definition.
- object
Type string - owners string[]
- parents
Get
Workflow Service Item Health Check Definition Result Parent[] - permission
Resources GetWorkflow Service Item Health Check Definition Result Permission Resource[] - service
Item GetDefinitions Workflow Service Item Health Check Definition Result Service Item Definition[] - string
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
Get
Workflow Service Item Health Check Definition Result Tag[] - version
Contexts GetWorkflow Service Item Health Check Definition Result Version Context[]
- account_
moid str - The Account ID for this managed object.
- additional_
properties str - ancestors
Sequence[Get
Workflow Service Item Health Check Definition Result Ancestor] - category str
- Category that the health check belongs to.
- class_
id str - common_
cause_ strand_ resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create_
time str - The time when this managed object was created.
- description str
- Description of the health check definition.
- domain_
group_ strmoid - The DomainGroup ID for this managed object.
- execution_
mode str - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health_
check_ Sequence[Getworkflows Workflow Service Item Health Check Definition Result Health Check Workflow] - label str
- Label for the health check definition that is displayed on UI.
- mod_
time str - The time when this managed object was last modified.
- moid str
- The unique identifier of this Managed Object instance.
- name str
- Name of the health check definition.
- object_
type str - owners Sequence[str]
- parents
Sequence[Get
Workflow Service Item Health Check Definition Result Parent] - permission_
resources Sequence[GetWorkflow Service Item Health Check Definition Result Permission Resource] - service_
item_ Sequence[Getdefinitions Workflow Service Item Health Check Definition Result Service Item Definition] - str
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
-
Sequence[Get
Workflow Service Item Health Check Definition Result Tag] - version_
contexts Sequence[GetWorkflow Service Item Health Check Definition Result Version Context]
- account
Moid String - The Account ID for this managed object.
- additional
Properties String - ancestors List<Property Map>
- category String
- Category that the health check belongs to.
- class
Id String - common
Cause StringAnd Resolution - Static information detailing the common cause for the health check failure.It also gives possible remediation actions that can be taken to remedy the health check failure.
- create
Time String - The time when this managed object was created.
- description String
- Description of the health check definition.
- domain
Group StringMoid - The DomainGroup ID for this managed object.
- execution
Mode String - Execution mode of the health check on service item.*
OnDemand- Execute the health check on-demand.*Periodic- Execute the health check on a periodic basis. - health
Check List<Property Map>Workflows - label String
- Label for the health check definition that is displayed on UI.
- mod
Time String - The time when this managed object was last modified.
- moid String
- The unique identifier of this Managed Object instance.
- name String
- Name of the health check definition.
- object
Type String - owners List<String>
- parents List<Property Map>
- permission
Resources List<Property Map> - service
Item List<Property Map>Definitions - String
- Intersight provides pre-built workflows, tasks and policies to end users through global catalogs.Objects that are made available through global catalogs are said to have a 'shared' ownership. Shared objects are either made globally available to all end users or restricted to end users based on their license entitlement. Users can use this property to differentiate the scope (global or a specific license tier) to which a shared MO belongs.
- List<Property Map>
- version
Contexts List<Property Map>
GetWorkflowServiceItemHealthCheckDefinitionResultAncestor
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflow
- Additional
Properties string - Catalog
Moid string - Class
Id string - Description string
- Description of the health check definition.
- Input
Parameters string - Label string
- Label for the health check definition that is displayed on UI.
- Name string
- Name of the health check definition.
- Nr
Version double - Object
Type string - Workflow
Definition stringName - Workflow
Definitions List<GetWorkflow Service Item Health Check Definition Result Health Check Workflow Workflow Definition>
- Additional
Properties string - Catalog
Moid string - Class
Id string - Description string
- Description of the health check definition.
- Input
Parameters string - Label string
- Label for the health check definition that is displayed on UI.
- Name string
- Name of the health check definition.
- Nr
Version float64 - Object
Type string - Workflow
Definition stringName - Workflow
Definitions []GetWorkflow Service Item Health Check Definition Result Health Check Workflow Workflow Definition
- additional_
properties string - catalog_
moid string - class_
id string - description string
- Description of the health check definition.
- input_
parameters string - label string
- Label for the health check definition that is displayed on UI.
- name string
- Name of the health check definition.
- nr_
version number - object_
type string - workflow_
definition_ stringname - workflow_
definitions list(object)
- additional
Properties String - catalog
Moid String - class
Id String - description String
- Description of the health check definition.
- input
Parameters String - label String
- Label for the health check definition that is displayed on UI.
- name String
- Name of the health check definition.
- nr
Version Double - object
Type String - workflow
Definition StringName - workflow
Definitions List<GetWorkflow Service Item Health Check Definition Result Health Check Workflow Workflow Definition>
- additional
Properties string - catalog
Moid string - class
Id string - description string
- Description of the health check definition.
- input
Parameters string - label string
- Label for the health check definition that is displayed on UI.
- name string
- Name of the health check definition.
- nr
Version number - object
Type string - workflow
Definition stringName - workflow
Definitions GetWorkflow Service Item Health Check Definition Result Health Check Workflow Workflow Definition[]
- additional_
properties str - catalog_
moid str - class_
id str - description str
- Description of the health check definition.
- input_
parameters str - label str
- Label for the health check definition that is displayed on UI.
- name str
- Name of the health check definition.
- nr_
version float - object_
type str - workflow_
definition_ strname - workflow_
definitions Sequence[GetWorkflow Service Item Health Check Definition Result Health Check Workflow Workflow Definition]
- additional
Properties String - catalog
Moid String - class
Id String - description String
- Description of the health check definition.
- input
Parameters String - label String
- Label for the health check definition that is displayed on UI.
- name String
- Name of the health check definition.
- nr
Version Number - object
Type String - workflow
Definition StringName - workflow
Definitions List<Property Map>
GetWorkflowServiceItemHealthCheckDefinitionResultHealthCheckWorkflowWorkflowDefinition
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionResultParent
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionResultPermissionResource
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionResultServiceItemDefinition
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionResultTag
- additional_
properties string - ancestor_
definitions list(object) - definitions list(object)
- key string
- propagated bool
- sys_
tag bool - type string
- value string
- additional
Properties String - ancestor
Definitions List<Property Map> - definitions List<Property Map>
- key String
- propagated Boolean
- sys
Tag Boolean - type String
- value String
GetWorkflowServiceItemHealthCheckDefinitionResultTagAncestorDefinition
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionResultTagDefinition
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionResultVersionContext
- Additional
Properties string - Class
Id string - Interested
Mos List<GetWorkflow Service Item Health Check Definition Result Version Context Interested Mo> - Marked
For boolDeletion - Nr
Version string - Object
Type string - Ref
Mos List<GetWorkflow Service Item Health Check Definition Result Version Context Ref Mo> - Timestamp string
- Version
Type string
- additional_
properties string - class_
id string - interested_
mos list(object) - marked_
for_ booldeletion - nr_
version string - object_
type string - ref_
mos list(object) - timestamp string
- version_
type string
- additional
Properties String - class
Id String - interested
Mos List<GetWorkflow Service Item Health Check Definition Result Version Context Interested Mo> - marked
For BooleanDeletion - nr
Version String - object
Type String - ref
Mos List<GetWorkflow Service Item Health Check Definition Result Version Context Ref Mo> - timestamp String
- version
Type String
- additional
Properties string - class
Id string - interested
Mos GetWorkflow Service Item Health Check Definition Result Version Context Interested Mo[] - marked
For booleanDeletion - nr
Version string - object
Type string - ref
Mos GetWorkflow Service Item Health Check Definition Result Version Context Ref Mo[] - timestamp string
- version
Type string
- additional_
properties str - class_
id str - interested_
mos Sequence[GetWorkflow Service Item Health Check Definition Result Version Context Interested Mo] - marked_
for_ booldeletion - nr_
version str - object_
type str - ref_
mos Sequence[GetWorkflow Service Item Health Check Definition Result Version Context Ref Mo] - timestamp str
- version_
type str
- additional
Properties String - class
Id String - interested
Mos List<Property Map> - marked
For BooleanDeletion - nr
Version String - object
Type String - ref
Mos List<Property Map> - timestamp String
- version
Type String
GetWorkflowServiceItemHealthCheckDefinitionResultVersionContextInterestedMo
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionResultVersionContextRefMo
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- Additional
Properties string - Class
Id string - Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - Selector string
- additional_
properties string - class_
id string - moid string
- The unique identifier of this Managed Object instance.
- object_
type string - selector string
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
- additional
Properties string - class
Id string - moid string
- The unique identifier of this Managed Object instance.
- object
Type string - selector string
- additional_
properties str - class_
id str - moid str
- The unique identifier of this Managed Object instance.
- object_
type str - selector str
- additional
Properties String - class
Id String - moid String
- The unique identifier of this Managed Object instance.
- object
Type String - selector String
GetWorkflowServiceItemHealthCheckDefinitionServiceItemDefinition
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetWorkflowServiceItemHealthCheckDefinitionTag
- Additional
Properties string - Ancestor
Definitions List<GetWorkflow Service Item Health Check Definition Tag Ancestor Definition> - Definition
Get
Workflow Service Item Health Check Definition Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- Key string
- The string representation of a tag key.
- Propagated bool
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- Sys
Tag bool - Specifies whether the tag is user-defined or owned by the system.
- Type string
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- Value string
- The string representation of a tag value.
- Additional
Properties string - Ancestor
Definitions []GetWorkflow Service Item Health Check Definition Tag Ancestor Definition - Definition
Get
Workflow Service Item Health Check Definition Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- Key string
- The string representation of a tag key.
- Propagated bool
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- Sys
Tag bool - Specifies whether the tag is user-defined or owned by the system.
- Type string
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- Value string
- The string representation of a tag value.
- additional_
properties string - ancestor_
definitions list(object) - definition object
- The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key string
- The string representation of a tag key.
- propagated bool
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys_
tag bool - Specifies whether the tag is user-defined or owned by the system.
- type string
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value string
- The string representation of a tag value.
- additional
Properties String - ancestor
Definitions List<GetWorkflow Service Item Health Check Definition Tag Ancestor Definition> - definition
Get
Workflow Service Item Health Check Definition Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key String
- The string representation of a tag key.
- propagated Boolean
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys
Tag Boolean - Specifies whether the tag is user-defined or owned by the system.
- type String
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value String
- The string representation of a tag value.
- additional
Properties string - ancestor
Definitions GetWorkflow Service Item Health Check Definition Tag Ancestor Definition[] - definition
Get
Workflow Service Item Health Check Definition Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key string
- The string representation of a tag key.
- propagated boolean
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys
Tag boolean - Specifies whether the tag is user-defined or owned by the system.
- type string
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value string
- The string representation of a tag value.
- additional_
properties str - ancestor_
definitions Sequence[GetWorkflow Service Item Health Check Definition Tag Ancestor Definition] - definition
Get
Workflow Service Item Health Check Definition Tag Definition - The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key str
- The string representation of a tag key.
- propagated bool
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys_
tag bool - Specifies whether the tag is user-defined or owned by the system.
- type str
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value str
- The string representation of a tag value.
- additional
Properties String - ancestor
Definitions List<Property Map> - definition Property Map
- The definition is a reference to the tag definition object. The tag definition object contains the properties of the tag such as name, type, and description.
- key String
- The string representation of a tag key.
- propagated Boolean
- Propagated is a boolean flag that indicates whether the tag is propagated to the related managed objects.
- sys
Tag Boolean - Specifies whether the tag is user-defined or owned by the system.
- type String
- An enum type that defines the type of tag. Supported values are 'pathtag' and 'keyvalue'.
KeyValue- KeyValue type of tag. Key is required for these tags. Value is optional.PathTag- Key contain path information. Value is not present for these tags. The path is created by using the '/' character as a delimiter.For example, if the tag is "A/B/C", then "A" is the parent tag, "B" is the child tag of "A" and "C" is the child tag of "B".
- value String
- The string representation of a tag value.
GetWorkflowServiceItemHealthCheckDefinitionTagAncestorDefinition
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetWorkflowServiceItemHealthCheckDefinitionTagDefinition
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetWorkflowServiceItemHealthCheckDefinitionVersionContext
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Interested
Mos List<GetWorkflow Service Item Health Check Definition Version Context Interested Mo> - Marked
For boolDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- Nr
Version string - The version of the Managed Object, e.g. an incrementing number or a hash id.
- Object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- Ref
Mo GetWorkflow Service Item Health Check Definition Version Context Ref Mo - A reference to the original Managed Object.
- Timestamp string
- The time this versioned Managed Object was created.
- Version
Type string - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Interested
Mos []GetWorkflow Service Item Health Check Definition Version Context Interested Mo - Marked
For boolDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- Nr
Version string - The version of the Managed Object, e.g. an incrementing number or a hash id.
- Object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- Ref
Mo GetWorkflow Service Item Health Check Definition Version Context Ref Mo - A reference to the original Managed Object.
- Timestamp string
- The time this versioned Managed Object was created.
- Version
Type string - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested_
mos list(object) - marked_
for_ booldeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr_
version string - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object_
type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref_
mo object - A reference to the original Managed Object.
- timestamp string
- The time this versioned Managed Object was created.
- version_
type string - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested
Mos List<GetWorkflow Service Item Health Check Definition Version Context Interested Mo> - marked
For BooleanDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr
Version String - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object
Type String - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref
Mo GetWorkflow Service Item Health Check Definition Version Context Ref Mo - A reference to the original Managed Object.
- timestamp String
- The time this versioned Managed Object was created.
- version
Type String - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested
Mos GetWorkflow Service Item Health Check Definition Version Context Interested Mo[] - marked
For booleanDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr
Version string - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object
Type string - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref
Mo GetWorkflow Service Item Health Check Definition Version Context Ref Mo - A reference to the original Managed Object.
- timestamp string
- The time this versioned Managed Object was created.
- version
Type string - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested_
mos Sequence[GetWorkflow Service Item Health Check Definition Version Context Interested Mo] - marked_
for_ booldeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr_
version str - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object_
type str - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref_
mo GetWorkflow Service Item Health Check Definition Version Context Ref Mo - A reference to the original Managed Object.
- timestamp str
- The time this versioned Managed Object was created.
- version_
type str - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- interested
Mos List<Property Map> - marked
For BooleanDeletion - The flag to indicate if snapshot is marked for deletion or not. If flag is set then snapshot will be removed after the successful deployment of the policy.
- nr
Version String - The version of the Managed Object, e.g. an incrementing number or a hash id.
- object
Type String - The fully-qualified name of the instantiated, concrete type. The value should be the same as the 'ClassId' property.
- ref
Mo Property Map - A reference to the original Managed Object.
- timestamp String
- The time this versioned Managed Object was created.
- version
Type String - Specifies type of version. Currently the only supported value is "Configured"
that is used to keep track of snapshots of policies and profiles that are intended
to be configured to target endpoints.
Modified- Version created every time an object is modified.Configured- Version created every time an object is configured to the service profile.Deployed- Version created for objects related to a service profile when it is deployed.
GetWorkflowServiceItemHealthCheckDefinitionVersionContextInterestedMo
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
GetWorkflowServiceItemHealthCheckDefinitionVersionContextRefMo
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- Additional
Properties string - Class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- Moid string
- The unique identifier of this Managed Object instance.
- Object
Type string - The fully-qualified name of the remote type referred by this relationship.
- Selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties string - class_
id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object_
type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties string - class
Id string - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid string
- The unique identifier of this Managed Object instance.
- object
Type string - The fully-qualified name of the remote type referred by this relationship.
- selector string
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional_
properties str - class_
id str - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid str
- The unique identifier of this Managed Object instance.
- object_
type str - The fully-qualified name of the remote type referred by this relationship.
- selector str
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
- additional
Properties String - class
Id String - The fully-qualified name of the instantiated, concrete type. This property is used as a discriminator to identify the type of the payload when marshaling and unmarshaling data.
- moid String
- The unique identifier of this Managed Object instance.
- object
Type String - The fully-qualified name of the remote type referred by this relationship.
- selector String
- An OData $filter expression which describes the REST resource to be referenced. This field may
be set instead of 'moid' by clients.
- If 'moid' is set this field is ignored.
- If 'selector' is set and 'moid' is empty/absent from the request, Intersight determines the Moid of the resource matching the filter expression and populates it in the MoRef that is part of the object instance being inserted/updated to fulfill the REST request. An error is returned if the filter matches zero or more than one REST resource. An example filter string is: Serial eq '3AA8B7T11'.
Package Details
- Repository
- intersight ciscodevnet/terraform-provider-intersight
- License
- Notes
- This Pulumi package is based on the
intersightTerraform Provider.
Viewing docs for intersight 1.0.78
published on Tuesday, Apr 21, 2026 by ciscodevnet
published on Tuesday, Apr 21, 2026 by ciscodevnet
